PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.365190.1
Common NameCsa_6G040640, LOC101206042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 287aa    MW: 32771.3 Da    PI: 6.8651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.365190.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-152875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed ll ++++ +G g+W+  a++ g++Rt+k+c++rw++yl
   Cucsa.365190.1 28 RGPWTIDEDTLLTHYIACHGEGHWNNLAKYAGLKRTGKSCRLRWLNYL 75
                     89********************************************97 PP

2Myb_DNA-binding54.52.6e-1781124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E++l+++++ ++G++ W++Ia+ ++ gRt++++k++w++
   Cucsa.365190.1  81 RGNFTPQEQLLILELHSKWGNR-WSKIAQQLP-GRTDNEIKNYWRT 124
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6752375IPR017930Myb domain
SuperFamilySSF466892.13E-3026122IPR009057Homeodomain-like
SMARTSM007171.7E-112777IPR001005SANT/Myb domain
PfamPF002493.5E-142875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-222982IPR009057Homeodomain-like
CDDcd001673.16E-83075No hitNo description
PROSITE profilePS5129425.78476130IPR017930Myb domain
SMARTSM007174.4E-1680128IPR001005SANT/Myb domain
PfamPF002492.3E-1681124IPR001005SANT/Myb domain
CDDcd001678.18E-1183124No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2483129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MESVRKSIIR NCNNNNNHNA SAENEVRRGP WTIDEDTLLT HYIACHGEGH WNNLAKYAGL  60
KRTGKSCRLR WLNYLKPDIK RGNFTPQEQL LILELHSKWG NRWSKIAQQL PGRTDNEIKN  120
YWRTRVEKQA KQLNIESNSK KFLETVRDLW IPRLLQKMDQ KSSSPNSSNY SPPPSLEETF  180
YQNSCGSSSS EATIEAKQTS IQSCGGYYQW PESSERASEE FGNNSDVQPL NNNNNGEFLH  240
VDQLQIQLQH PFSLLGATCG GAEFDGQMAA SDWVLQDDKS ESLWNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-242513024128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818171e-169LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132571e-169LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140978.20.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0A0KC910.0A0A0A0KC91_CUCSA; Uncharacterized protein
STRINGVIT_01s0011g03730.t012e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-80myb domain protein 62
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]